SCOPe 2.08: Domain d2r87e1: 2r87 E:1-99

Lineage for d2r87e1 (2r87 E:1-99)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
   Pfam PF06849; DUF1246

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)

7. Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries)
   Uniprot Q8U0R7 1-99

8. Domain d2r87e1: 2r87 E:1-99 [151692]
   Other proteins in same PDB: d2r87a2, d2r87b2, d2r87c2, d2r87d2, d2r87e2, d2r87f2
   automated match to d2r84a1
   complexed with adp, po4

Details for d2r87e1

PDB Entry: 2r87, 2.3 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with adp

PDB Compounds: (E:) PurP protein PF1517

SCOPe Domain Sequences for d2r87e1:

Sequence; same for both SEQRES and ATOM records:

>d2r87e1 c.30.1.8 (E:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes

Timeline for d2r87e1:

• d2r87e1 first appeared in SCOP 1.75
  
• d2r87e1 appears in SCOPe 2.07