Lineage for d2r87b2 (2r87 B:100-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978864Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 2978865Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 2978871Species Pyrococcus furiosus [TaxId:2261] [160808] (4 PDB entries)
    Uniprot Q8U0R7 100-334
  8. 2978877Domain d2r87b2: 2r87 B:100-334 [151687]
    Other proteins in same PDB: d2r87a1, d2r87b1, d2r87c1, d2r87d1, d2r87e1, d2r87f1
    automated match to d2r84a2
    complexed with adp, po4

Details for d2r87b2

PDB Entry: 2r87 (more details), 2.3 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with adp
PDB Compounds: (B:) PurP protein PF1517

SCOPe Domain Sequences for d2r87b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r87b2 d.142.1.9 (B:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkphgakggkgyflakdpedfwrkaekfl
gikrkedlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdql
efdmditytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlef
vvfeisarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt

SCOPe Domain Coordinates for d2r87b2:

Click to download the PDB-style file with coordinates for d2r87b2.
(The format of our PDB-style files is described here.)

Timeline for d2r87b2: