Lineage for d2r5zb_ (2r5z B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1078589Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1078778Protein automated matches [190360] (2 species)
    not a true protein
  7. 1078779Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)
  8. 1078784Domain d2r5zb_: 2r5z B: [151598]
    automated match to d1pufb_
    protein/DNA complex

Details for d2r5zb_

PDB Entry: 2r5z (more details), 2.6 Å

PDB Description: structure of scr/exd complex bound to a dna sequence derived from the fkh gene
PDB Compounds: (B:) Homeobox protein extradenticle

SCOPe Domain Sequences for d2r5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5zb_ a.4.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkni

SCOPe Domain Coordinates for d2r5zb_:

Click to download the PDB-style file with coordinates for d2r5zb_.
(The format of our PDB-style files is described here.)

Timeline for d2r5zb_: