Lineage for d2qw6c_ (2qw6 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719131Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2719132Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2719193Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
    automatically mapped to Pfam PF12002
  6. 2719194Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)
  7. 2719195Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
    Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328
  8. 2719198Domain d2qw6c_: 2qw6 C: [151403]
    automated match to d2qw6a1
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2qw6c_

PDB Entry: 2qw6 (more details), 2.3 Å

PDB Description: crystal structure of the c-terminal domain of an aaa atpase from enterococcus faecium do
PDB Compounds: (C:) AAA ATPase, central region

SCOPe Domain Sequences for d2qw6c_:

Sequence, based on SEQRES records: (download)

>d2qw6c_ a.80.1.2 (C:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaartvn
avlaaeklglpearipladvvvdlcl

Sequence, based on observed residues (ATOM records): (download)

>d2qw6c_ a.80.1.2 (C:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedinpaaaartvnavl
aaeklglpearipladvvvdlcl

SCOPe Domain Coordinates for d2qw6c_:

Click to download the PDB-style file with coordinates for d2qw6c_.
(The format of our PDB-style files is described here.)

Timeline for d2qw6c_: