| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
| Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins) automatically mapped to Pfam PF12002 |
| Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species) |
| Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries) Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328 |
| Domain d2qw6c_: 2qw6 C: [151403] automated match to d2qw6a1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2qw6 (more details), 2.3 Å
SCOPe Domain Sequences for d2qw6c_:
Sequence, based on SEQRES records: (download)
>d2qw6c_ a.80.1.2 (C:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaartvn
avlaaeklglpearipladvvvdlcl
>d2qw6c_ a.80.1.2 (C:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedinpaaaartvnavl
aaeklglpearipladvvvdlcl
Timeline for d2qw6c_: