SCOPe 2.08: Domain d2qw6a1: 2qw6 A:241-328

Lineage for d2qw6a1 (2qw6 A:241-328)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
   automatically mapped to Pfam PF12002

6. Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
   Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328

8. Domain d2qw6a1: 2qw6 A:241-328 [151401]
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2qw6a1

PDB Entry: 2qw6, 2.3 Å

PDB Description: crystal structure of the c-terminal domain of an aaa atpase from enterococcus faecium do

PDB Compounds: (A:) AAA ATPase, central region

SCOPe Domain Sequences for d2qw6a1:

Sequence, based on SEQRES records:

>d2qw6a1 a.80.1.2 (A:241-328) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaartvn
avlaaeklglpearipladvvvdlclsp

Sequence, based on observed residues (ATOM records):

>d2qw6a1 a.80.1.2 (A:241-328) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedinpaaaartvnavl
aaeklglpearipladvvvdlclsp

Timeline for d2qw6a1:

• d2qw6a1 first appeared in SCOP 1.75
  
• d2qw6a1 appears in SCOPe 2.07