Class a: All alpha proteins [46456] (290 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins) automatically mapped to Pfam PF12002 |
Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species) |
Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries) Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328 |
Domain d2qw6b_: 2qw6 B: [151402] automated match to d2qw6a1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2qw6 (more details), 2.3 Å
SCOPe Domain Sequences for d2qw6b_:
Sequence, based on SEQRES records: (download)
>d2qw6b_ a.80.1.2 (B:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaartvn avlaaeklglpearipladvvvdlclsp
>d2qw6b_ a.80.1.2 (B:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} ydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedinpaaaartvnavl aaeklglpearipladvvvdlclsp
Timeline for d2qw6b_: