SCOPe 2.08: Domain d2qscl1: 2qsc L:3-107

Lineage for d2qscl1 (2qsc L:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d2qscl1: 2qsc L:3-107 [151316]
   Other proteins in same PDB: d2qscl2
   automatically matched to d1rhha1
   complexed with cl, zn

Details for d2qscl1

PDB Entry: 2qsc, 2.8 Å

PDB Description: crystal structure analysis of anti-hiv-1 v3-fab f425-b4e8 in complex with a v3-peptide

PDB Compounds: (L:) Fab F425-B4e8, Light chain

SCOPe Domain Sequences for d2qscl1:

Sequence; same for both SEQRES and ATOM records:

>d2qscl1 b.1.1.1 (L:3-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
vltqspsslsasvgdrvtitcqasqdisnylnwyqhkpgkapklliytasnletgvpsrf
sgggsgthfsftitslqpedaatyfcqqydnlgdlsfgggtkveik

Timeline for d2qscl1:

• d2qscl1 first appeared in SCOP 1.75
  
• d2qscl1 appears in SCOPe 2.07