![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Hypothetical protein Ta0289 [102899] (1 species) contains extra C-terminal zinc-finger domain |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries) |
![]() | Domain d2qh1a1: 2qh1 A:1-142 [150784] complexed with fe2 |
PDB Entry: 2qh1 (more details), 2 Å
SCOPe Domain Sequences for d2qh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qh1a1 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]} mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd lsrylsrasitdillshrtkdy
Timeline for d2qh1a1: