Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Hypothetical protein Ta0289 [102899] (1 species) contains extra C-terminal zinc-finger domain |
Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries) |
Domain d2qh1a1: 2qh1 A:1-142 [150784] Other proteins in same PDB: d2qh1a2, d2qh1b2 complexed with fe2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2qh1 (more details), 2 Å
SCOPe Domain Sequences for d2qh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qh1a1 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]} mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd lsrylsrasitdillshrtkdy
Timeline for d2qh1a1: