Lineage for d2qfrb2 (2qfr B:121-432)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679879Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1679903Protein automated matches [190524] (2 species)
    not a true protein
  7. 1679904Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries)
  8. 1679914Domain d2qfrb2: 2qfr B:121-432 [150753]
    Other proteins in same PDB: d2qfra1, d2qfrb1
    automated match to d1kbpa2
    complexed with fe, nag, ndg, so4, zn

Details for d2qfrb2

PDB Entry: 2qfr (more details), 2.4 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase with bound sulfate
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d2qfrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfrb2 d.159.1.1 (B:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d2qfrb2:

Click to download the PDB-style file with coordinates for d2qfrb2.
(The format of our PDB-style files is described here.)

Timeline for d2qfrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qfrb1