Lineage for d2qfrb1 (2qfr B:9-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523538Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 1523557Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 1523558Protein automated matches [227090] (1 species)
    not a true protein
  7. 1523559Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries)
  8. 1523569Domain d2qfrb1: 2qfr B:9-120 [150752]
    Other proteins in same PDB: d2qfra2, d2qfrb2
    automated match to d2qfra1
    complexed with fe, nag, ndg, so4, zn

Details for d2qfrb1

PDB Entry: 2qfr (more details), 2.4 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase with bound sulfate
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d2qfrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfrb1 b.1.12.0 (B:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d2qfrb1:

Click to download the PDB-style file with coordinates for d2qfrb1.
(The format of our PDB-style files is described here.)

Timeline for d2qfrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qfrb2