![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
![]() | Protein automated matches [190524] (2 species) not a true protein |
![]() | Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries) |
![]() | Domain d2qfrb2: 2qfr B:121-432 [150753] Other proteins in same PDB: d2qfra1, d2qfrb1 automated match to d1kbpa2 complexed with fe, nag, ndg, so4, zn |
PDB Entry: 2qfr (more details), 2.4 Å
SCOPe Domain Sequences for d2qfrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfrb2 d.159.1.1 (B:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvddst
Timeline for d2qfrb2: