Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Escherichia coli [TaxId:562] [159086] (27 PDB entries) Uniprot P60422 3-124 |
Domain d2qbkc2: 2qbk C:61-124 [150622] Other proteins in same PDB: d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbk61, d2qbkc1, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki1, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1 protein/RNA complex; complexed with lll, mg, zn protein/RNA complex; complexed with lll, mg, zn missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2qbk (more details), 4 Å
SCOPe Domain Sequences for d2qbkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbkc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd aaik
Timeline for d2qbkc2:
View in 3D Domains from other chains: (mouse over for more information) d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbk61, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki1, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1 |