Lineage for d2qbkc2 (2qbk C:61-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799829Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 799881Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 799895Domain d2qbkc2: 2qbk C:61-124 [150622]
    Other proteins in same PDB: d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbk61, d2qbkc1, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki1, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1
    automatically matched to 2AW4 C:61-124
    complexed with lll, mg, zn

Details for d2qbkc2

PDB Entry: 2qbk (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d2qbkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbkc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOP Domain Coordinates for d2qbkc2:

Click to download the PDB-style file with coordinates for d2qbkc2.
(The format of our PDB-style files is described here.)

Timeline for d2qbkc2: