SCOPe 2.07: Domain d2qbkc2: 2qbk C:61-124

Lineage for d2qbkc2 (2qbk C:61-124)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2qbkc2: 2qbk C:61-124 [150622]
   Other proteins in same PDB: d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbk61, d2qbkc1, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki1, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1
   protein/RNA complex; complexed with lll, mg, zn
   protein/RNA complex; complexed with lll, mg, zn

Details for d2qbkc2

PDB Entry: 2qbk, 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qbkc2:

Sequence; same for both SEQRES and ATOM records:

>d2qbkc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2qbkc2:

• d2qbkc2 first appeared in SCOP 1.75
  
• d2qbkc2 appears in SCOPe 2.06
  
• d2qbkc2 appears in the current release, SCOPe 2.08