SCOPe 2.08: Domain d2q9oa2: 2q9o A:163-343

Lineage for d2q9oa2 (2q9o A:163-343)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Laccase, middle domain [418906] (5 species)

7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419308] (9 PDB entries)

8. Domain d2q9oa2: 2q9o A:163-343 [150150]
   Other proteins in same PDB: d2q9oa1, d2q9oa3, d2q9ob1, d2q9ob3
   automated match to d1gw0a2
   complexed with cl, cu, gol, nag, oxy, so4

Details for d2q9oa2

PDB Entry: 2q9o, 1.3 Å

PDB Description: near-atomic resolution structure of a melanocarpus albomyces laccase

PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d2q9oa2:

Sequence; same for both SEQRES and ATOM records:

>d2q9oa2 b.6.1.3 (A:163-343) Laccase, middle domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg
krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra
pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv
p

Timeline for d2q9oa2:

• d2q9oa2 first appeared in SCOP 1.75
  
• d2q9oa2 appears in SCOPe 2.07