![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, N-terminal domain [418905] (5 species) |
![]() | Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419307] (9 PDB entries) |
![]() | Domain d2q9oa1: 2q9o A:1-162 [150149] Other proteins in same PDB: d2q9oa2, d2q9oa3, d2q9ob2, d2q9ob3 automated match to d1gw0a1 complexed with cl, cu, gol, nag, oxy, so4 |
PDB Entry: 2q9o (more details), 1.3 Å
SCOPe Domain Sequences for d2q9oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9oa1 b.6.1.3 (A:1-162) Laccase, N-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]} eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp
Timeline for d2q9oa1: