Lineage for d1gw0a2 (1gw0 A:163-343)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771321Protein Laccase, middle domain [418906] (5 species)
  7. 2771322Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419308] (9 PDB entries)
  8. 2771337Domain d1gw0a2: 1gw0 A:163-343 [70624]
    Other proteins in same PDB: d1gw0a1, d1gw0a3, d1gw0b1, d1gw0b3
    complexed with cl, cu, nag, oxy, so4

Details for d1gw0a2

PDB Entry: 1gw0 (more details), 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form
PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d1gw0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw0a2 b.6.1.3 (A:163-343) Laccase, middle domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg
krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra
pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv
p

SCOPe Domain Coordinates for d1gw0a2:

Click to download the PDB-style file with coordinates for d1gw0a2.
(The format of our PDB-style files is described here.)

Timeline for d1gw0a2: