Lineage for d1gw0a3 (1gw0 A:344-559)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Laccase, C-terminal domain [418907] (5 species)
  7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries)
  8. Domain d1gw0a3: 1gw0 A:344-559 [70625]
    Other proteins in same PDB: d1gw0a1, d1gw0a2, d1gw0b1, d1gw0b2
    complexed with cl, cu, nag, oxy, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1gw0a3

PDB Entry: 1gw0 (more details), 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form
PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d1gw0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw0a3 b.6.1.3 (A:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

SCOPe Domain Coordinates for d1gw0a3 are not available.

Timeline for d1gw0a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gw0a1, d1gw0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gw0b1, d1gw0b2, d1gw0b3