PDB entry 1gw0

View 1gw0 on RCSB PDB site
Description: Crystal Structure of Laccase from Melanocarpus albomyces in Four Copper Form
Class: oxidoreductase
Keywords: oxidoreductase, laccase, multi-copper oxidases, oxygen reduction, ascomycete, c-terminal plug
Deposited on 2002-03-01, released 2002-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gw0a1, d1gw0a2, d1gw0a3
  • Chain 'B':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gw0b1, d1gw0b2, d1gw0b3
  • Heterogens: OXY, CU, CL, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw0A (A:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw0B (B:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl