| Class b: All beta proteins [48724] (177 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
| Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries) |
| Domain d2q8ib_: 2q8i B: [150128] Other proteins in same PDB: d2q8ia1, d2q8ia3 automated match to d1fyca_ complexed with gol, k, rdc, red |
PDB Entry: 2q8i (more details), 2.6 Å
SCOPe Domain Sequences for d2q8ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q8ib_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafady
Timeline for d2q8ib_: