Lineage for d2q8ib_ (2q8i B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817438Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2817439Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2817451Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 2817460Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)
  8. 2817468Domain d2q8ib_: 2q8i B: [150128]
    Other proteins in same PDB: d2q8ia1, d2q8ia3
    automated match to d1fyca_
    complexed with gol, k, rdc, red

Details for d2q8ib_

PDB Entry: 2q8i (more details), 2.6 Å

PDB Description: pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
PDB Compounds: (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2q8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8ib_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafady

SCOPe Domain Coordinates for d2q8ib_:

Click to download the PDB-style file with coordinates for d2q8ib_.
(The format of our PDB-style files is described here.)

Timeline for d2q8ib_: