SCOPe 2.07: Domain d2q1ya1: 2q1y A:8-205

Lineage for d2q1ya1 (2q1y A:8-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
   Uniprot O08378

8. Domain d2q1ya1: 2q1y A:8-205 [150004]
   Other proteins in same PDB: d2q1ya2, d2q1yb2
   automatically matched to d1rlua1
   complexed with gsp

Details for d2q1ya1

PDB Entry: 2q1y, 2.3 Å

PDB Description: crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with gtp-gamma-s

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2q1ya1:

Sequence; same for both SEQRES and ATOM records:

>d2q1ya1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Timeline for d2q1ya1:

• d2q1ya1 first appeared in SCOP 1.75
  
• d2q1ya1 appears in SCOPe 2.06
  
• d2q1ya1 appears in the current release, SCOPe 2.08