| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein Cell-division protein FtsZ [52492] (9 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries) Uniprot O08378 |
| Domain d2q1ya1: 2q1y A:8-205 [150004] Other proteins in same PDB: d2q1ya2, d2q1yb2 automatically matched to d1rlua1 complexed with gsp |
PDB Entry: 2q1y (more details), 2.3 Å
SCOPe Domain Sequences for d2q1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q1ya1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin
Timeline for d2q1ya1: