SCOPe 2.07: Domain d2q1ya2: 2q1y A:206-312

Lineage for d2q1ya2 (2q1y A:206-312)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
   Uniprot O08378

8. Domain d2q1ya2: 2q1y A:206-312 [150005]
   Other proteins in same PDB: d2q1ya1, d2q1yb1
   automatically matched to d1rlua2
   complexed with gsp

Details for d2q1ya2

PDB Entry: 2q1y, 2.3 Å

PDB Description: crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with gtp-gamma-s

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2q1ya2:

Sequence; same for both SEQRES and ATOM records:

>d2q1ya2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

Timeline for d2q1ya2:

• d2q1ya2 first appeared in SCOP 1.75
  
• d2q1ya2 appears in SCOPe 2.06
  
• d2q1ya2 appears in the current release, SCOPe 2.08