SCOP 1.75: Domain d2pz2a2: 2pz2 A:11-60,A:182-354

Lineage for d2pz2a2 (2pz2 A:11-60,A:182-354)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Homo sapiens [TaxId:9606] [159560] (3 PDB entries)

8. Domain d2pz2a2: 2pz2 A:11-60,A:182-354 [149961]
   Other proteins in same PDB: d2pz2a1
   automatically matched to d1agra2
   complexed with gdp, so4; mutant

Details for d2pz2a2

PDB Entry: 2pz2, 2.6 Å

PDB Description: Crystal structure of the GDP-bound conformation of a G-alpha-i1 mutant with enhanced GTPase activity

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2pz2a2:

Sequence; same for both SEQRES and ATOM records:

>d2pz2a2 c.37.1.8 (A:11-60,A:182-354) Transducin (alpha subunit) {Homo sapiens [TaxId: 9606]}
aaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethft
fkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklf
dsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedl
nkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Timeline for d2pz2a2:

• d2pz2a2 is new in SCOP 1.75
  
• d2pz2a2 last appears in SCOPe 2.01