| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
| Species Human (Homo sapiens) [TaxId:9606] [159560] (3 PDB entries) |
| Domain d2pz2a2: 2pz2 A:11-60,A:182-354 [149961] Other proteins in same PDB: d2pz2a1 automatically matched to d1agra2 complexed with gdp, so4; mutant |
PDB Entry: 2pz2 (more details), 2.6 Å
SCOPe Domain Sequences for d2pz2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz2a2 c.37.1.8 (A:11-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
aaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethft
fkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklf
dsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedl
nkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
Timeline for d2pz2a2: