![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Homo sapiens [TaxId:9606] [158559] (3 PDB entries) |
![]() | Domain d2pz2a1: 2pz2 A:61-181 [149960] Other proteins in same PDB: d2pz2a2 automatically matched to d1agra1 complexed with gdp, so4; mutant |
PDB Entry: 2pz2 (more details), 2.6 Å
SCOP Domain Sequences for d2pz2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz2a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Homo sapiens [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d2pz2a1: