Lineage for d2pyja1 (2pyj A:5-187)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996218Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 996273Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 996274Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. 996277Domain d2pyja1: 2pyj A:5-187 [149943]
    Other proteins in same PDB: d2pyja2, d2pyjb2
    automatically matched to d1xhxa1
    protein/DNA complex; complexed with dgt, edo, mg, mn

Details for d2pyja1

PDB Entry: 2pyj (more details), 2.03 Å

PDB Description: phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2pyja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyja1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOPe Domain Coordinates for d2pyja1:

Click to download the PDB-style file with coordinates for d2pyja1.
(The format of our PDB-style files is described here.)

Timeline for d2pyja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pyja2