Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species) |
Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries) Uniprot P03680 |
Domain d2pyja1: 2pyj A:5-187 [149943] Other proteins in same PDB: d2pyja2, d2pyjb2 automated match to d1xhxa1 protein/DNA complex; complexed with dgt, edo, mg, mn |
PDB Entry: 2pyj (more details), 2.03 Å
SCOPe Domain Sequences for d2pyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyja1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg ldr
Timeline for d2pyja1: