Class a: All alpha proteins [46456] (290 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein Uncharacterized protein TM1040_2465 [158823] (1 species) |
Species Silicibacter sp. tm1040 [TaxId:292414] [158824] (1 PDB entry) Uniprot Q1GDR9 1-190 |
Domain d2pfxb2: 2pfx B:1-190 [149453] Other proteins in same PDB: d2pfxa2, d2pfxb3 automated match to d2pfxa1 complexed with act, cl, pg4 |
PDB Entry: 2pfx (more details), 1.7 Å
SCOPe Domain Sequences for d2pfxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pfxb2 a.152.1.3 (B:1-190) Uncharacterized protein TM1040_2465 {Silicibacter sp. tm1040 [TaxId: 292414]} mtkpkeptaldlpmadplpdetqkyfeicqeklgmvpnvlkayafnveklnaftamyndl mlgesqlskleremiavvvssinkcfyclvahgaavrqlsgdpqlgemlvmnyrvaplda rqrvmldfaakmtrasaeieeadrevlrshgfndrdiwdianvtgffnmtnrvasatamm pnaeyhgqfr
Timeline for d2pfxb2: