Lineage for d2pfxa1 (2pfx A:1-190)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735160Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 2735199Protein Uncharacterized protein TM1040_2465 [158823] (1 species)
  7. 2735200Species Silicibacter sp. tm1040 [TaxId:292414] [158824] (1 PDB entry)
    Uniprot Q1GDR9 1-190
  8. 2735201Domain d2pfxa1: 2pfx A:1-190 [149452]
    Other proteins in same PDB: d2pfxa2, d2pfxb3
    complexed with act, cl, pg4

Details for d2pfxa1

PDB Entry: 2pfx (more details), 1.7 Å

PDB Description: crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution
PDB Compounds: (A:) Uncharacterized peroxidase-related protein

SCOPe Domain Sequences for d2pfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfxa1 a.152.1.3 (A:1-190) Uncharacterized protein TM1040_2465 {Silicibacter sp. tm1040 [TaxId: 292414]}
mtkpkeptaldlpmadplpdetqkyfeicqeklgmvpnvlkayafnveklnaftamyndl
mlgesqlskleremiavvvssinkcfyclvahgaavrqlsgdpqlgemlvmnyrvaplda
rqrvmldfaakmtrasaeieeadrevlrshgfndrdiwdianvtgffnmtnrvasatamm
pnaeyhgqfr

SCOPe Domain Coordinates for d2pfxa1:

Click to download the PDB-style file with coordinates for d2pfxa1.
(The format of our PDB-style files is described here.)

Timeline for d2pfxa1:

2735201
d2pfxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2pfxa2