SCOPe 2.07: Domain d2p61a1: 2p61 A:34-152

Lineage for d2p61a1 (2p61 A:34-152)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.29: TM1646-like [158397] (2 families)
   automatically mapped to Pfam PF03885

5. Family a.24.29.1: TM1646-like [158398] (1 protein)
   Pfam PF03885; DUF327

6. Protein Hypothetical protein TM1646 [158399] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [158400] (1 PDB entry)
   Uniprot Q9X1X9 34-152

8. Domain d2p61a1: 2p61 A:34-152 [149266]
   Other proteins in same PDB: d2p61a2

Details for d2p61a1

PDB Entry: 2p61, 2.7 Å

PDB Description: crystal structure of protein tm1646 from thermotoga maritima, pfam duf327

PDB Compounds: (A:) Hypothetical protein TM_1646

SCOPe Domain Sequences for d2p61a1:

Sequence, based on SEQRES records:

>d2p61a1 a.24.29.1 (A:34-152) Hypothetical protein TM1646 {Thermotoga maritima [TaxId: 2336]}
effdiledvkedhfeklleeaveevidsgnelvrsptpsnlkryknaikeflkliekkiy
klagsfdmnsgrarlhlvveevneklmdltekimknewqtinlaarieeinglilnlyr

Sequence, based on observed residues (ATOM records):

>d2p61a1 a.24.29.1 (A:34-152) Hypothetical protein TM1646 {Thermotoga maritima [TaxId: 2336]}
effdiledvkedhfeklleeaveevidsgnelvrsptpsnlkryknaikeflkliekkiy
klnsgrarlhlvveevneklmdltekimknewqtinlaarieeinglilnlyr

Timeline for d2p61a1:

• d2p61a1 first appeared in SCOP 1.75
  
• d2p61a1 appears in SCOPe 2.06
  
• d2p61a1 appears in the current release, SCOPe 2.08