PDB entry 2p61

View 2p61 on RCSB PDB site
Description: Crystal structure of protein TM1646 from Thermotoga maritima, Pfam DUF327
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-03-16, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein TM_1646
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_1646
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1X9 (Start-153)
      • cloning artifact (154)
    Domains in SCOPe 2.07: d2p61a1, d2p61a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2p61A (A:)
mslridplggeslknqevkgkksgktsrvgeskkkeffdiledvkedhfeklleeaveev
idsgnelvrsptpsnlkryknaikeflkliekkiyklagsfdmnsgrarlhlvveevnek
lmdltekimknewqtinlaarieeinglilnlyreghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2p61A (A:)
effdiledvkedhfeklleeaveevidsgnelvrsptpsnlkryknaikeflkliekkiy
klnsgrarlhlvveevneklmdltekimknewqtinlaarieeinglilnlyre