![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.383: PG1388-like [160924] (1 superfamily) consists of 2 alpha+beta subdomains, each having a meander beta-sheet; d1: alpha(2)-beta(7); d2: alpha(2)-beta(2)-alpha(2)-beta(2) |
![]() | Superfamily d.383.1: PG1388-like [160925] (1 family) ![]() automatically mapped to Pfam PF11644 |
![]() | Family d.383.1.1: PG1388-like [160926] (1 protein) PfamB PB104512 |
![]() | Protein Hypothetical protein PG1388 [160927] (1 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [160928] (1 PDB entry) Uniprot Q7MUU3 66-262 |
![]() | Domain d2p3pb_: 2p3p B: [149184] automated match to d2p3pa1 complexed with mg |
PDB Entry: 2p3p (more details), 1.76 Å
SCOPe Domain Sequences for d2p3pb_:
Sequence, based on SEQRES records: (download)
>d2p3pb_ d.383.1.1 (B:) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]} vagelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnf iriqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpr iedfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaif lspeplvyrwqsgrfvrqvr
>d2p3pb_ d.383.1.1 (B:) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]} vagelercflampesvlpivtmeerndlcrraghlsgfthtaslessgtvtfllnrnfir iqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqprie dfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaifls peplvyrwqsgrfvrqvr
Timeline for d2p3pb_: