Lineage for d2p3pa1 (2p3p A:66-262)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.383: PG1388-like [160924] (1 superfamily)
consists of 2 alpha+beta subdomains, each having a meander beta-sheet; d1: alpha(2)-beta(7); d2: alpha(2)-beta(2)-alpha(2)-beta(2)Superfamily d.383.1: PG1388-like [160925] (1 family) 
automatically mapped to Pfam PF11644Family d.383.1.1: PG1388-like [160926] (1 protein)
PfamB PB104512Protein Hypothetical protein PG1388 [160927] (1 species) Species Porphyromonas gingivalis [TaxId:837] [160928] (1 PDB entry)
Uniprot Q7MUU3 66-262
Domain d2p3pa1: 2p3p A:66-262 [149183]
complexed with mg
Details for d2p3pa1
PDB Entry: 2p3p (more details), 1.76 Å
PDB Description: Structure of a domain of an uncharacterized protein PG_1388 from Porphyromonas gingivalis W83
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2p3pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p3pa1 d.383.1.1 (A:66-262) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]}
agelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnfi
riqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpri
edfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaifl
speplvyrwqsgrfvrq
SCOPe Domain Coordinates for d2p3pa1:
Click to download the PDB-style file with coordinates for d2p3pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p3pa1:
- d2p3pa1 first appeared in SCOP 1.75
- d2p3pa1 appears in SCOPe 2.07
View in 3D
