SCOPe 2.08: Domain d2p3pa1: 2p3p A:66-262

Lineage for d2p3pa1 (2p3p A:66-262)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.383: PG1388-like [160924] (1 superfamily)
   consists of 2 alpha+beta subdomains, each having a meander beta-sheet; d1: alpha(2)-beta(7); d2: alpha(2)-beta(2)-alpha(2)-beta(2)

4. Superfamily d.383.1: PG1388-like [160925] (1 family)
   automatically mapped to Pfam PF11644

5. Family d.383.1.1: PG1388-like [160926] (1 protein)
   PfamB PB104512

6. Protein Hypothetical protein PG1388 [160927] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [160928] (1 PDB entry)
   Uniprot Q7MUU3 66-262

8. Domain d2p3pa1: 2p3p A:66-262 [149183]
   complexed with mg

Details for d2p3pa1

PDB Entry: 2p3p, 1.76 Å

PDB Description: Structure of a domain of an uncharacterized protein PG_1388 from Porphyromonas gingivalis W83

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2p3pa1:

Sequence; same for both SEQRES and ATOM records:

>d2p3pa1 d.383.1.1 (A:66-262) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]}
agelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnfi
riqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpri
edfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaifl
speplvyrwqsgrfvrq

Timeline for d2p3pa1:

• d2p3pa1 first appeared in SCOP 1.75
  
• d2p3pa1 appears in SCOPe 2.07