Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.383: PG1388-like [160924] (1 superfamily) consists of 2 alpha+beta subdomains, each having a meander beta-sheet; d1: alpha(2)-beta(7); d2: alpha(2)-beta(2)-alpha(2)-beta(2) |
Superfamily d.383.1: PG1388-like [160925] (1 family) |
Family d.383.1.1: PG1388-like [160926] (1 protein) PfamB PB104512 |
Protein Hypothetical protein PG1388 [160927] (1 species) |
Species Porphyromonas gingivalis [TaxId:837] [160928] (1 PDB entry) Uniprot Q7MUU3 66-262 |
Domain d2p3pb1: 2p3p B:66-262 [149184] automatically matched to 2P3P A:66-262 complexed with mg |
PDB Entry: 2p3p (more details), 1.76 Å
SCOP Domain Sequences for d2p3pb1:
Sequence, based on SEQRES records: (download)
>d2p3pb1 d.383.1.1 (B:66-262) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]} agelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnfi riqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpri edfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaifl speplvyrwqsgrfvrq
>d2p3pb1 d.383.1.1 (B:66-262) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]} agelercflampesvlpivtmeerndlcrraghlsgfthtaslessgtvtfllnrnfiri qtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpried fflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaiflsp eplvyrwqsgrfvrq
Timeline for d2p3pb1: