Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
Protein vp4 sialic acid binding domain [74908] (1 species) |
Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries) |
Domain d2p3ia_: 2p3i A: [149178] automated match to d1kqra_ complexed with mna, so4 |
PDB Entry: 2p3i (more details), 1.75 Å
SCOPe Domain Sequences for d2p3ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p3ia_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]} vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn vttkyysttnydsvnmtafcdfyiipreeestcteyinngl
Timeline for d2p3ia_: