Lineage for d1kqra_ (1kqr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780402Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2780403Protein vp4 sialic acid binding domain [74908] (1 species)
  7. 2780404Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries)
  8. 2780405Domain d1kqra_: 1kqr A: [72886]
    in complex with 2-O-methyl-alpha-D-N-acetyl neuraminic acid
    complexed with gol, mna, so4

Details for d1kqra_

PDB Entry: 1kqr (more details), 1.4 Å

PDB Description: crystal structure of the rhesus rotavirus vp4 sialic acid binding domain in complex with 2-o-methyl-alpha-d-n-acetyl neuraminic acid
PDB Compounds: (A:) vp4

SCOPe Domain Sequences for d1kqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqra_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
ldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfgt
qeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpnv
ttkyysttnydsvnmtafcdfyiipreeestcteyinngl

SCOPe Domain Coordinates for d1kqra_:

Click to download the PDB-style file with coordinates for d1kqra_.
(The format of our PDB-style files is described here.)

Timeline for d1kqra_: