PDB entry 2p3i

View 2p3i on RCSB PDB site
Description: Crystal structure of Rhesus Rotavirus VP8* at 295K
Class: viral protein
Keywords: beta-sandwich, VIRAL PROTEIN
Deposited on 2007-03-09, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp4
    Species: Rotavirus A [TaxId:10969]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p3ia_
  • Heterogens: SO4, MNA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p3iA (A:)
vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg
tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
vttkyysttnydsvnmtafcdfyiipreeestcteyinngl