SCOP 1.75: Domain d2p3ia1: 2p3i A:65-224

Lineage for d2p3ia1 (2p3i A:65-224)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (1 protein)

6. Protein vp4 sialic acid binding domain [74908] (1 species)

7. Species Rhesus rotavirus [TaxId:10969] [74909] (4 PDB entries)

8. Domain d2p3ia1: 2p3i A:65-224 [149178]
   automatically matched to d1kqra_
   complexed with mna, so4

Details for d2p3ia1

PDB Entry: 2p3i, 1.75 Å

PDB Description: crystal structure of rhesus rotavirus vp8* at 295k

PDB Compounds: (A:) vp4

SCOP Domain Sequences for d2p3ia1:

Sequence; same for both SEQRES and ATOM records:

>d2p3ia1 b.29.1.14 (A:65-224) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
ldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfgt
qeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpnv
ttkyysttnydsvnmtafcdfyiipreeestcteyinngl

Timeline for d2p3ia1:

• d2p3ia1 is new in SCOP 1.75
  
• d2p3ia1 is called d2p3ia_ in SCOPe 2.01
  
• d2p3ia1 appears in the current release, SCOPe 2.08, called d2p3ia_