SCOPe 2.05: Domain d2oz1c2: 2oz1 C:151-261

Lineage for d2oz1c2 (2oz1 C:151-261)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
   two-domain cytochrome c with novel domain arrangement

6. Protein Di-heme cytochrome c SoxA [81678] (1 species)
   cysteine persulfide(cys sulfane) heme coordination

7. Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)

8. Domain d2oz1c2: 2oz1 C:151-261 [149089]
   Other proteins in same PDB: d2oz1b_, d2oz1d_, d2oz1f_, d2oz1h_
   automated match to d1h32a2
   complexed with hec

Details for d2oz1c2

PDB Entry: 2oz1, 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum

PDB Compounds: (C:) diheme cytochrome c

SCOPe Domain Sequences for d2oz1c2:

Sequence; same for both SEQRES and ATOM records:

>d2oz1c2 a.3.1.8 (C:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna
rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn

Timeline for d2oz1c2:

• d2oz1c2 first appeared in SCOP 1.75
  
• d2oz1c2 appears in SCOPe 2.04
  
• d2oz1c2 appears in SCOPe 2.06
  
• d2oz1c2 appears in the current release, SCOPe 2.08