Lineage for d2oz1h_ (2oz1 H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719996Protein Mono-heme c-type cytochrome SoxX [81675] (1 species)
  7. 1719997Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries)
  8. 1720003Domain d2oz1h_: 2oz1 H: [149096]
    Other proteins in same PDB: d2oz1a1, d2oz1a2, d2oz1c1, d2oz1c2, d2oz1e1, d2oz1e2, d2oz1g1, d2oz1g2
    automated match to d1h31b_
    complexed with hec

Details for d2oz1h_

PDB Entry: 2oz1 (more details), 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum
PDB Compounds: (H:) cytochrome c

SCOPe Domain Sequences for d2oz1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz1h_ a.3.1.1 (H:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq

SCOPe Domain Coordinates for d2oz1h_:

Click to download the PDB-style file with coordinates for d2oz1h_.
(The format of our PDB-style files is described here.)

Timeline for d2oz1h_: