Lineage for d2oz1c2 (2oz1 C:151-261)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691592Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 2691593Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cysteine persulfide(cys sulfane) heme coordination
  7. 2691594Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)
  8. 2691602Domain d2oz1c2: 2oz1 C:151-261 [149089]
    Other proteins in same PDB: d2oz1b_, d2oz1d_, d2oz1f_, d2oz1h_
    automated match to d1h32a2
    complexed with hec

Details for d2oz1c2

PDB Entry: 2oz1 (more details), 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum
PDB Compounds: (C:) diheme cytochrome c

SCOPe Domain Sequences for d2oz1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz1c2 a.3.1.8 (C:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna
rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn

SCOPe Domain Coordinates for d2oz1c2:

Click to download the PDB-style file with coordinates for d2oz1c2.
(The format of our PDB-style files is described here.)

Timeline for d2oz1c2: