Lineage for d2op7a_ (2op7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077689Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2077690Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2077691Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2077784Protein automated matches [192459] (3 species)
    not a true protein
  7. 2077787Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)
  8. 2077807Domain d2op7a_: 2op7 A: [148960]
    automated match to d1jmqa_

Details for d2op7a_

PDB Entry: 2op7 (more details)

PDB Description: ww4
PDB Compounds: (A:) NEDD4-like E3 ubiquitin-protein ligase WWP1

SCOPe Domain Sequences for d2op7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op7a_ b.72.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neeplpegweirytregvryfvdhntrtttfkdprngks

SCOPe Domain Coordinates for d2op7a_:

Click to download the PDB-style file with coordinates for d2op7a_.
(The format of our PDB-style files is described here.)

Timeline for d2op7a_: