PDB entry 2op7

View 2op7 on RCSB PDB site
Description: ww4
Class: ligase
Keywords: WW domain, Beta sheet, LIGASE
Deposited on 2007-01-27, released 2007-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NEDD4-like E3 ubiquitin-protein ligase WWP1
  Species: Homo sapiens [TaxId:9606]
  Gene: WWP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H0M0 (0-38)
  Domains in SCOPe 2.06: d2op7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2op7A (A:)
  neeplpegweirytregvryfvdhntrtttfkdprngks