Lineage for d2op7a1 (2op7 A:5-35)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901446Fold k.22: WW domain-based designs [58912] (1 superfamily)
  4. 901447Superfamily k.22.1: WW domain-based designs [58913] (1 family) (S)
  5. 901448Family k.22.1.1: WW domain-based designs [58914] (2 proteins)
  6. 901452Protein Prototype WW domain [58915] (3 species)
  7. 901453Species Homo sapiens [TaxId:9606] [161325] (1 PDB entry)
  8. 901454Domain d2op7a1: 2op7 A:5-35 [148960]
    automatically matched to d1e0ma_

Details for d2op7a1

PDB Entry: 2op7 (more details)

PDB Description: ww4
PDB Compounds: (A:) NEDD4-like E3 ubiquitin-protein ligase WWP1

SCOP Domain Sequences for d2op7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op7a1 k.22.1.1 (A:5-35) Prototype WW domain {Homo sapiens [TaxId: 9606]}
lpegweirytregvryfvdhntrtttfkdpr

SCOP Domain Coordinates for d2op7a1:

Click to download the PDB-style file with coordinates for d2op7a1.
(The format of our PDB-style files is described here.)

Timeline for d2op7a1: