SCOPe 2.08: Domain d2omub2: 2omu B:2-101

Lineage for d2omub2 (2omu B:2-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d2omub2: 2omu B:2-101 [148884]
   Other proteins in same PDB: d2omua1, d2omua3, d2omub3
   automated match to d1o6sb_
   complexed with ca, cl

Details for d2omub2

PDB Entry: 2omu, 1.8 Å

PDB Description: crystal structure of inla g194s+s y369s/hec1 complex

PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omub2:

Sequence; same for both SEQRES and ATOM records:

>d2omub2 b.1.6.1 (B:2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
wvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk
vtepldreriatytlfshavssngnavedpmeilitvtdq

Timeline for d2omub2:

• d2omub2 first appeared in SCOP 1.75, called d2omub1
  
• d2omub2 appears in SCOPe 2.07