PDB entry 2omu

View 2omu on RCSB PDB site
Description: Crystal structure of InlA G194S+S Y369S/hEC1 complex
Class: cell invasion/cell adhesion
Keywords: leucine-rich-repeat, invasion protein, IG-like domain, adhesion protein, CELL INVASION-CELL ADHESION COMPLEX
Deposited on 2007-01-23, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Internalin-A
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: inlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25146 (0-461)
      • engineered (158-159)
      • engineered (334)
    Domains in SCOPe 2.07: d2omua1, d2omua3
  • Chain 'B':
    Compound: epithelial-cadherin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12830 (5-104)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2omub2, d2omub3
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omuA (A:)
    atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
    ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
    didplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldi
    ssnkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltn
    ltdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledisp
    isnlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnq
    isdltplanltritqlglndqawtnapvnykanvsipntvknvtgaliapatisdggsyt
    epditwnlpsytnevsytfsqpvtigkgtttfsgtvtqplka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omuB (B:)
    gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere
    tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdq